PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10011606
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family MYB
Protein Properties Length: 363aa    MW: 40408.3 Da    PI: 6.5609
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10011606genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding521.7e-161462148
                     TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                     +g+W++eEd +l+ ++ q+G+g +W + ++++g++R++k+c++rw++yl
      Lus10011606 14 KGPWSPEEDAKLKSYIDQHGTGgNWIALPQKIGLKRCGKSCRLRWLNYL 62
                     79*********************************************97 PP

2Myb_DNA-binding33.41e-1070111346
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                       ++ +Ed ++  +    G++ W+ Ia+ ++ gRt++++k++w++
      Lus10011606  70 GFSDQEDHIICSLYLSIGSR-WSIIAAQLP-GRTDNDIKNYWNT 111
                      699*****************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129420.528966IPR017930Myb domain
SuperFamilySSF466891.75E-2511109IPR009057Homeodomain-like
SMARTSM007173.7E-121364IPR001005SANT/Myb domain
PfamPF002492.3E-151462IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.3E-241569IPR009057Homeodomain-like
CDDcd001672.40E-91662No hitNo description
SMARTSM007174.4E-867115IPR001005SANT/Myb domain
PROSITE profilePS5129415.08167117IPR017930Myb domain
PfamPF002492.2E-969111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.5E-2270117IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 363 aa     Download sequence    Send to blast
MGRAPCCDKA NVKKGPWSPE EDAKLKSYID QHGTGGNWIA LPQKIGLKRC GKSCRLRWLN  60
YLRPNLKHGG FSDQEDHIIC SLYLSIGSRW SIIAAQLPGR TDNDIKNYWN TRLKKKLLGS  120
KHHRKSNDHT ARRTNNTFLK HSDDTPSPML PPPDHDLMMM MMMDHHQKEI AAAAAHQYWL  180
PGIMMAALPP PDMLVTKLQG SAGNLVFHNN DNEYDQNQYN NQQQLQAMMG NSTSTTSLSP  240
NSSVSMESSF ANPSSSVLVF QDLSTSFLAG LGMGNDDNDD RLAVVHNPLE LDDDLQNWYG  300
SYDQQMGDGG SSSSESTGKN VNPMVGYFDP LLQHLVSDNY STEIHGFLPP LEQSPIYFSP  360
PQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A6e-24141177108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A072VEW32e-84A0A072VEW3_MEDTR; Myb transcription factor
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF13034340
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G49690.12e-79myb domain protein 84